RP9 polyclonal antibody
  • RP9 polyclonal antibody

RP9 polyclonal antibody

Ref: AB-PAB22562
RP9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RP9.
Información adicional
Size 100 uL
Gene Name RP9
Gene Alias PAP-1
Gene Description retinitis pigmentosa 9 (autosomal dominant)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PEQELQRRREQKRRRHDAQQLQQLKHLESFYEKPPPGLIKEDETKPEDCIPDVPGNEHAREFLAHAPTKGLWM
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RP9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6100
Iso type IgG

Enviar uma mensagem


RP9 polyclonal antibody

RP9 polyclonal antibody