HRNR polyclonal antibody
  • HRNR polyclonal antibody

HRNR polyclonal antibody

Ref: AB-PAB22558
HRNR polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HRNR.
Información adicional
Size 100 uL
Gene Name HRNR
Gene Alias S100A16|S100a18
Gene Description hornerin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq WSAGENDSYSRNVRGSLKPGTESISRRLSFQRDFSGQHNSYSGQSSSYGEQNSDSHQSSGRGQCGSGS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HRNR.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 388697
Iso type IgG

Enviar uma mensagem


HRNR polyclonal antibody

HRNR polyclonal antibody