FAM83B polyclonal antibody
  • FAM83B polyclonal antibody

FAM83B polyclonal antibody

Ref: AB-PAB22556
FAM83B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM83B.
Información adicional
Size 100 uL
Gene Name FAM83B
Gene Alias C6orf143|FLJ30642|MGC126677|MGC138480
Gene Description family with sequence similarity 83, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ALGDRFEGYDNPENLKANALYTHSRLRSSLVFKPTLPEQKEVNSCTTGSSNSTIIGSQGSETPKEVPDTPTNVQHLTDKPLPESIPKLPLQS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM83B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 222584
Iso type IgG

Enviar uma mensagem


FAM83B polyclonal antibody

FAM83B polyclonal antibody