ZNF512 polyclonal antibody
  • ZNF512 polyclonal antibody

ZNF512 polyclonal antibody

Ref: AB-PAB22552
ZNF512 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF512.
Información adicional
Size 100 uL
Gene Name ZNF512
Gene Alias KIAA1805|MGC111046
Gene Description zinc finger protein 512
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PKTQPNPKSQARRIRKEPPVYAAGSLEEQWYLEIVDKGSVSCPTCQAVGRKTIEGLKKHMENCKQEMFTCHHCGKQLRSLAGMKYHVMANH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF512.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84450
Iso type IgG

Enviar uma mensagem


ZNF512 polyclonal antibody

ZNF512 polyclonal antibody