PPCS polyclonal antibody
  • PPCS polyclonal antibody

PPCS polyclonal antibody

Ref: AB-PAB22546
PPCS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPCS.
Información adicional
Size 100 uL
Gene Name PPCS
Gene Alias FLJ11838|MGC117357|MGC138220
Gene Description phosphopantothenoylcysteine synthetase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLAVEFTTLADY
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPCS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79717
Iso type IgG

Enviar uma mensagem


PPCS polyclonal antibody

PPCS polyclonal antibody