CPAMD8 polyclonal antibody
  • CPAMD8 polyclonal antibody

CPAMD8 polyclonal antibody

Ref: AB-PAB22542
CPAMD8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CPAMD8.
Información adicional
Size 100 uL
Gene Name CPAMD8
Gene Alias FLJ42058|FLJ90618|K-CAP|KIAA1283|VIP
Gene Description C3 and PZP-like, alpha-2-macroglobulin domain containing 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SDLGLNNITAKALAYGDTNCCRDGRSSKHPEENHADRRVPIGVDHVRRSVMVEAEGVPRAYTYSAFFCPSERVHISTPNKYEFQYVQR
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CPAMD8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27151
Iso type IgG

Enviar uma mensagem


CPAMD8 polyclonal antibody

CPAMD8 polyclonal antibody