ZNF772 polyclonal antibody
  • ZNF772 polyclonal antibody

ZNF772 polyclonal antibody

Ref: AB-PAB22539
ZNF772 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF772.
Información adicional
Size 100 uL
Gene Name ZNF772
Gene Alias DKFZp686I1569
Gene Description zinc finger protein 772
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KPFRSDKSRPFLLNNCAVQSMEMSFVTGEACKDFLASSSIFEHHAPHNEWKPHSNTKCEEASHCG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF772.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 400720
Iso type IgG

Enviar uma mensagem


ZNF772 polyclonal antibody

ZNF772 polyclonal antibody