MDGA1 polyclonal antibody
  • MDGA1 polyclonal antibody

MDGA1 polyclonal antibody

Ref: AB-PAB22533
MDGA1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MDGA1.
Información adicional
Size 100 uL
Gene Name MDGA1
Gene Alias DKFZp686K0262|DKFZp686L0262|FLJ45018|GPIM|MAMDC3
Gene Description MAM domain containing glycosylphosphatidylinositol anchor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AHVPISPSGPFQIIFEGVRGPGYLGDIAIDDVTLKKGECPRKQTDPNKVVVMPGSGAPCQSSPQLWGPMAIFLLALQR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MDGA1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 266727
Iso type IgG

Enviar uma mensagem


MDGA1 polyclonal antibody

MDGA1 polyclonal antibody