ZNF518B polyclonal antibody
  • ZNF518B polyclonal antibody

ZNF518B polyclonal antibody

Ref: AB-PAB22529
ZNF518B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF518B.
Información adicional
Size 100 uL
Gene Name ZNF518B
Gene Alias KIAA1729
Gene Description zinc finger protein 518B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AKCKSVHKISLQDLQKGTGKDGMYVCFQCSLGAAPPNFHFVSNNSSATHVGNKTENFSSSVNSKFKVRNFKPGKYYCDKCRF
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF518B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 85460
Iso type IgG

Enviar uma mensagem


ZNF518B polyclonal antibody

ZNF518B polyclonal antibody