KTI12 polyclonal antibody
  • KTI12 polyclonal antibody

KTI12 polyclonal antibody

Ref: AB-PAB22527
KTI12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KTI12.
Información adicional
Size 100 uL
Gene Name KTI12
Gene Alias MGC20419|RP11-91A18.3|SBBI81|TOT4
Gene Description KTI12 homolog, chromatin associated (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PLCLVYCVRPGGPIAGPQVAGANENPGRNVSVSWRPRAEEDGRAQAAGSSVLRELHTADSVVNGSAQADVPKELEREESG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KTI12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 112970
Iso type IgG

Enviar uma mensagem


KTI12 polyclonal antibody

KTI12 polyclonal antibody