DNAJC6 polyclonal antibody
  • DNAJC6 polyclonal antibody

DNAJC6 polyclonal antibody

Ref: AB-PAB22525
DNAJC6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNAJC6.
Información adicional
Size 100 uL
Gene Name DNAJC6
Gene Alias DJC6|KIAA0473|MGC129914|MGC129915|MGC48436
Gene Description DnaJ (Hsp40) homolog, subfamily C, member 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NGDKPHGVKKPSKKQQEPAAPPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSGVEDVFHPSGPASTQSTP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNAJC6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9829
Iso type IgG

Enviar uma mensagem


DNAJC6 polyclonal antibody

DNAJC6 polyclonal antibody