CDCP2 polyclonal antibody
  • CDCP2 polyclonal antibody

CDCP2 polyclonal antibody

Ref: AB-PAB22519
CDCP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CDCP2.
Información adicional
Size 100 uL
Gene Name CDCP2
Gene Alias -
Gene Description CUB domain containing protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RGNFSSPQYPSSYPNNIRCHWTIRLPPGYQVKVFFLDLDLEEPNSLTKTCDFDHLAAFDGASEEAPLLGNWCGHHLPPPVTSSHNQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CDCP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 200008
Iso type IgG

Enviar uma mensagem


CDCP2 polyclonal antibody

CDCP2 polyclonal antibody