FRYL polyclonal antibody
  • FRYL polyclonal antibody

FRYL polyclonal antibody

Ref: AB-PAB22514
FRYL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FRYL.
Información adicional
Size 100 uL
Gene Name FRYL
Gene Alias DKFZp686E205|FLJ16177|KIAA0826
Gene Description FRY-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq AYCKLINQVNTIKNEAEVINMSEELAQLESILKEAESASENEEIDISKAAQTTIETAIHSLIETLKNKEFISAVAQVKA
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FRYL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 285527
Iso type IgG

Enviar uma mensagem


FRYL polyclonal antibody

FRYL polyclonal antibody