PISD polyclonal antibody
  • PISD polyclonal antibody

PISD polyclonal antibody

Ref: AB-PAB22508
PISD polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PISD.
Información adicional
Size 100 uL
Gene Name PISD
Gene Alias DJ858B16|DKFZp566G2246|PSDC|PSSC|dJ858B16.2
Gene Description phosphatidylserine decarboxylase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq YKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHSISPSD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PISD.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23761
Iso type IgG

Enviar uma mensagem


PISD polyclonal antibody

PISD polyclonal antibody