GALNTL6 polyclonal antibody
  • GALNTL6 polyclonal antibody

GALNTL6 polyclonal antibody

Ref: AB-PAB22502
GALNTL6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GALNTL6.
Información adicional
Size 100 uL
Gene Name GALNTL6
Gene Alias GALNT17|MGC44629
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DKHLVKSAEPGEQQTFPLGLGDGQFYSWTDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPLTEEDHDDSAYRENGFNIFVSN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GALNTL6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 442117
Iso type IgG

Enviar uma mensagem


GALNTL6 polyclonal antibody

GALNTL6 polyclonal antibody