N4BP3 polyclonal antibody
  • N4BP3 polyclonal antibody

N4BP3 polyclonal antibody

Ref: AB-PAB22501
N4BP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant N4BP3.
Información adicional
Size 100 uL
Gene Name N4BP3
Gene Alias KIAA0341
Gene Description Nedd4 binding protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FSPEELRAALAGSRGSRQPDGLLRKGLGQREFLSYLHLPKKDSKSTKNTKRAPRNEPADYATLYYREHSRAGDFSKTSLPERGRFD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human N4BP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23138
Iso type IgG

Enviar uma mensagem


N4BP3 polyclonal antibody

N4BP3 polyclonal antibody