SH3BGRL3 polyclonal antibody
  • SH3BGRL3 polyclonal antibody

SH3BGRL3 polyclonal antibody

Ref: AB-PAB22496
SH3BGRL3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SH3BGRL3.
Información adicional
Size 100 uL
Gene Name SH3BGRL3
Gene Alias SH3BP-1|TIP-B1
Gene Description SH3 domain binding glutamic acid-rich protein like 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SH3BGRL3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83442
Iso type IgG

Enviar uma mensagem


SH3BGRL3 polyclonal antibody

SH3BGRL3 polyclonal antibody