LRRC59 polyclonal antibody
  • LRRC59 polyclonal antibody

LRRC59 polyclonal antibody

Ref: AB-PAB22490
LRRC59 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC59.
Información adicional
Size 100 uL
Gene Name LRRC59
Gene Alias FLJ21675|PRO1855
Gene Description leucine rich repeat containing 59
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq CRVTELQQQPLCTSVNTIYDNAVQGLRRHEILQWVLQTDSQQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC59.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55379
Iso type IgG

Enviar uma mensagem


LRRC59 polyclonal antibody

LRRC59 polyclonal antibody