HEATR6 polyclonal antibody
  • HEATR6 polyclonal antibody

HEATR6 polyclonal antibody

Ref: AB-PAB22487
HEATR6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HEATR6.
Información adicional
Size 100 uL
Gene Name HEATR6
Gene Alias ABC1|DKFZp686D22141|FLJ22087|MGC148096
Gene Description HEAT repeat containing 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMGSIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGAL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HEATR6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 63897
Iso type IgG

Enviar uma mensagem


HEATR6 polyclonal antibody

HEATR6 polyclonal antibody