GPR137C polyclonal antibody
  • GPR137C polyclonal antibody

GPR137C polyclonal antibody

Ref: AB-PAB22484
GPR137C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GPR137C.
Información adicional
Size 100 uL
Gene Name GPR137C
Gene Alias DKFZp762F0713|TM7SF1L2
Gene Description G protein-coupled receptor 137C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RAQRLNQNLAPAGMINSHSYSSRAYFFDNPRRYDSDDDLPRLGSSREGSLPNSQSLGWYGTMTGCGSSSYTVTPHLNGPMTDTAP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GPR137C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283554
Iso type IgG

Enviar uma mensagem


GPR137C polyclonal antibody

GPR137C polyclonal antibody