MIPEP polyclonal antibody
  • MIPEP polyclonal antibody

MIPEP polyclonal antibody

Ref: AB-PAB22478
MIPEP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MIPEP.
Información adicional
Size 100 uL
Gene Name MIPEP
Gene Alias HMIP|MIP
Gene Description mitochondrial intermediate peptidase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LRFSHLVGYGARYYSYLMSRAVASMVWKECFLQDPFNRAAGERYRREMLAHGGGREPMLMVEGMLQKCPSVDDFVSALVSDLDLDFETFLMDS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MIPEP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4285
Iso type IgG

Enviar uma mensagem


MIPEP polyclonal antibody

MIPEP polyclonal antibody