TMEM63C polyclonal antibody
  • TMEM63C polyclonal antibody

TMEM63C polyclonal antibody

Ref: AB-PAB22474
TMEM63C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM63C.
Información adicional
Size 100 uL
Gene Name TMEM63C
Gene Alias C14orf171
Gene Description transmembrane protein 63C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GSVVTRVHFCYDVRNLIDLDDQRRHAMRGRLFYTAKAKKTGKVMIRIHPCARLCFCKCWTCFKEVDAEQYYSELEEQLTDEFNAELNRVPLKRLDLIFVTFQDSRMAKRVRKDYKYVQCGVQPQQSSVTTIVKSYYWRVTMA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM63C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57156
Iso type IgG

Enviar uma mensagem


TMEM63C polyclonal antibody

TMEM63C polyclonal antibody