ZFP14 polyclonal antibody
  • ZFP14 polyclonal antibody

ZFP14 polyclonal antibody

Ref: AB-PAB22472
ZFP14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZFP14.
Información adicional
Size 100 uL
Gene Name ZFP14
Gene Alias KIAA1559|ZNF531
Gene Description zinc finger protein 14 homolog (mouse)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AQRDLYRDVMWENYSNFISLAGPSISKPDVITLLDEERKEPGMVVREGTRRYCPDLESRYRTNTLSPEKDIYEIYSFQWDIMERIKSYSLQGSIFRNDWECKSKIEGEKEQQEGYFGQVKITSE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZFP14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57677
Iso type IgG

Enviar uma mensagem


ZFP14 polyclonal antibody

ZFP14 polyclonal antibody