TMEM61 polyclonal antibody
  • TMEM61 polyclonal antibody

TMEM61 polyclonal antibody

Ref: AB-PAB22469
TMEM61 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM61.
Información adicional
Size 100 uL
Gene Name TMEM61
Gene Alias -
Gene Description transmembrane protein 61
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PRWDPYHLSRDLYYLTVESSEKESCRTPKVVDIPTYEEAVSFPVAEGPPTPPAYPTEEALEPSGSRDALLSTQPAWPPPSYESISLALDAVSAETTPSATRSCSGLVQTARG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM61.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 199964
Iso type IgG

Enviar uma mensagem


TMEM61 polyclonal antibody

TMEM61 polyclonal antibody