ZNF195 polyclonal antibody
  • ZNF195 polyclonal antibody

ZNF195 polyclonal antibody

Ref: AB-PAB22467
ZNF195 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF195.
Información adicional
Size 100 uL
Gene Name ZNF195
Gene Alias DKFZp666D035
Gene Description zinc finger protein 195
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CGECGKTFIQCSHFTEPENIDTGEKPYKCQECNNVIKTCSVLTKNRIYAGGEHYRCEEFGKVFNQCSHLTEHEHGTEEKPCKYEECSSVFISCSSLSNQQMILAGEKLSKCETWYKGFNHSPNPSKHQRNEIGGK
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF195.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7748
Iso type IgG

Enviar uma mensagem


ZNF195 polyclonal antibody

ZNF195 polyclonal antibody