LRRC16B polyclonal antibody
  • LRRC16B polyclonal antibody

LRRC16B polyclonal antibody

Ref: AB-PAB22466
LRRC16B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC16B.
Información adicional
Size 100 uL
Gene Name LRRC16B
Gene Alias C14orf121|crml-1
Gene Description leucine rich repeat containing 16B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CDYNGLHCREEVQWDVDTIYHAEDNREFNLLDFSHLESRDLALMVAALAYNQWFTKLYCKDLRLGSEVLEQVLHTLSKSGSLEELVLDNAGLKTDFVQKLAGVFGENGSCVLHALTL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC16B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90668
Iso type IgG

Enviar uma mensagem


LRRC16B polyclonal antibody

LRRC16B polyclonal antibody