IL22RA2 polyclonal antibody
  • IL22RA2 polyclonal antibody

IL22RA2 polyclonal antibody

Ref: AB-PAB22465
IL22RA2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IL22RA2.
Información adicional
Size 100 uL
Gene Name IL22RA2
Gene Alias CRF2-10|CRF2-S1|CRF2X|IL-22BP|MGC150509|MGC150510
Gene Description interleukin 22 receptor, alpha 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IL22RA2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 116379
Iso type IgG

Enviar uma mensagem


IL22RA2 polyclonal antibody

IL22RA2 polyclonal antibody