BHLHE23 polyclonal antibody
  • BHLHE23 polyclonal antibody

BHLHE23 polyclonal antibody

Ref: AB-PAB22464
BHLHE23 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BHLHE23.
Información adicional
Size 100 uL
Gene Name BHLHE23
Gene Alias BETA4|BHLHB4|bA305P22.3
Gene Description basic helix-loop-helix family, member e23
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RLVAFLNQGQGLAAPVNAAPLTPFGQATVCPFSAGAALGPCPDKCAAFSGTPSALCKHCHEKP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BHLHE23.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 128408
Iso type IgG

Enviar uma mensagem


BHLHE23 polyclonal antibody

BHLHE23 polyclonal antibody