UFL1 polyclonal antibody
  • UFL1 polyclonal antibody

UFL1 polyclonal antibody

Ref: AB-PAB22459
UFL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UFL1.
Información adicional
Size 100 uL
Gene Name UFL1
Gene Alias KIAA0776|Maxer|NLBP|RCAD|RP3-393D12.1
Gene Description UFM1-specific ligase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GLFSAITRPTAVNSLISKYGFQEQLLYSVLEELVNSGRLRGTVVGGRQDKAVFVPDIYSRTQSTWVDSFFRQNGYLEFDALSRLGIPDAVS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UFL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23376
Iso type IgG

Enviar uma mensagem


UFL1 polyclonal antibody

UFL1 polyclonal antibody