TSR2 polyclonal antibody
  • TSR2 polyclonal antibody

TSR2 polyclonal antibody

Ref: AB-PAB22457
TSR2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TSR2.
Información adicional
Size 100 uL
Gene Name TSR2
Gene Alias DT1P1A10|MGC20451|WGG1
Gene Description TSR2, 20S rRNA accumulation, homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AVENGFGGVHSQEKAKWLGGAVEDYFMRNADLELDEVEDFLGELLTNEFDTVVEDGSLPQVSQQLQTMFHHFQRGDGAALREMASCITQRKCKVTATALKTARETDEDEDDVDSVEEMEVT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TSR2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90121
Iso type IgG

Enviar uma mensagem


TSR2 polyclonal antibody

TSR2 polyclonal antibody