YPEL3 polyclonal antibody
  • YPEL3 polyclonal antibody

YPEL3 polyclonal antibody

Ref: AB-PAB22456
YPEL3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant YPEL3.
Información adicional
Size 100 uL
Gene Name YPEL3
Gene Alias MGC10500
Gene Description yippee-like 3 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQK
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human YPEL3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83719
Iso type IgG

Enviar uma mensagem


YPEL3 polyclonal antibody

YPEL3 polyclonal antibody