KCNH5 polyclonal antibody
  • KCNH5 polyclonal antibody

KCNH5 polyclonal antibody

Ref: AB-PAB22454
KCNH5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KCNH5.
Información adicional
Size 100 uL
Gene Name KCNH5
Gene Alias EAG2|H-EAG2|Kv10.2
Gene Description potassium voltage-gated channel, subfamily H (eag-related), member 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KCNH5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27133
Iso type IgG

Enviar uma mensagem


KCNH5 polyclonal antibody

KCNH5 polyclonal antibody