LDLRAD2 polyclonal antibody
  • LDLRAD2 polyclonal antibody

LDLRAD2 polyclonal antibody

Ref: AB-PAB22452
LDLRAD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LDLRAD2.
Información adicional
Size 100 uL
Gene Name LDLRAD2
Gene Alias -
Gene Description low density lipoprotein receptor class A domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GMDNCGDGSDQGSWSPADCRGPSPVPSQTGSTDAHTSRSLTPSPALGSAGSLWIAAERSSPAGRDPTRQDAALEGSTE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LDLRAD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 401944
Iso type IgG

Enviar uma mensagem


LDLRAD2 polyclonal antibody

LDLRAD2 polyclonal antibody