MAGEB4 polyclonal antibody
  • MAGEB4 polyclonal antibody

MAGEB4 polyclonal antibody

Ref: AB-PAB22450
MAGEB4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MAGEB4.
Información adicional
Size 100 uL
Gene Name MAGEB4
Gene Alias MGC33144
Gene Description melanoma antigen family B, 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KVGQPTAAEKEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGDESQDEENASSSQASTSTERSLKDSLTRKTKMLVQFLLYKYKMKEPTTKAEMLKIISKKYKEHFPE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAGEB4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4115
Iso type IgG

Enviar uma mensagem


MAGEB4 polyclonal antibody

MAGEB4 polyclonal antibody