TNFRSF13B polyclonal antibody
  • TNFRSF13B polyclonal antibody

TNFRSF13B polyclonal antibody

Ref: AB-PAB22449
TNFRSF13B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TNFRSF13B.
Información adicional
Size 100 uL
Gene Name TNFRSF13B
Gene Alias CD267|CVID|FLJ39942|MGC133214|MGC39952|TACI|TNFRSF14B
Gene Description tumor necrosis factor receptor superfamily, member 13B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQE
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TNFRSF13B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23495
Iso type IgG

Enviar uma mensagem


TNFRSF13B polyclonal antibody

TNFRSF13B polyclonal antibody