MICAL2 polyclonal antibody
  • MICAL2 polyclonal antibody

MICAL2 polyclonal antibody

Ref: AB-PAB22448
MICAL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MICAL2.
Información adicional
Size 100 uL
Gene Name MICAL2
Gene Alias DKFZp686H03148|DKFZp686H2469|KIAA0750|MICAL2PV1|MICAL2PV2
Gene Description microtubule associated monoxygenase, calponin and LIM domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PVTTGKEMASAQEPDKLSMVMYLSKFYELFRGTPLRPVDSWRKNYGENADLSLAKSSISNNYLNLTFPRKRTPRVDGQTGENDMNKRRRKGFTNLDEPSNFSSRSLGSNQECGSSKEGGNQNKVKSM
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MICAL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9645
Iso type IgG

Enviar uma mensagem


MICAL2 polyclonal antibody

MICAL2 polyclonal antibody