SLC37A1 polyclonal antibody
  • SLC37A1 polyclonal antibody

SLC37A1 polyclonal antibody

Ref: AB-PAB22445
SLC37A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC37A1.
Información adicional
Size 100 uL
Gene Name SLC37A1
Gene Alias FLJ22340|G3PP
Gene Description solute carrier family 37 (glycerol-3-phosphate transporter), member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IVKGELHKYCTAWDEADVRFSSQNRKSGSAAPHQLPDNETDCGWAPFDKNNY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC37A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54020
Iso type IgG

Enviar uma mensagem


SLC37A1 polyclonal antibody

SLC37A1 polyclonal antibody