TXLNB polyclonal antibody
  • TXLNB polyclonal antibody

TXLNB polyclonal antibody

Ref: AB-PAB22443
TXLNB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TXLNB.
Información adicional
Size 100 uL
Gene Name TXLNB
Gene Alias C6orf198|DKFZp451A175|LST001|MDP77|dJ522B19.2
Gene Description taxilin beta
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ALQEERNELHKKIRDAEISEKDDQSQHNSDEEPESNVSVDQEIDAEEVNSVQTAVKNLATAFMIIHHPESTPHQSKETQPEI
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TXLNB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 167838
Iso type IgG

Enviar uma mensagem


TXLNB polyclonal antibody

TXLNB polyclonal antibody