NT5DC1 polyclonal antibody
  • NT5DC1 polyclonal antibody

NT5DC1 polyclonal antibody

Ref: AB-PAB22437
NT5DC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NT5DC1.
Información adicional
Size 100 uL
Gene Name NT5DC1
Gene Alias C6orf200|LP2642|MGC131837|MGC24302|NT5C2L1
Gene Description 5'-nucleotidase domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GFFSHLPSQRPFRTLENDEEQEALPSLDKPGWYSQGNAVHLYELLKKMTGKPEPKVVYFGDSMHSDIFPARHYSNWETVLILEELR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NT5DC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 221294
Iso type IgG

Enviar uma mensagem


NT5DC1 polyclonal antibody

NT5DC1 polyclonal antibody