MTMR11 polyclonal antibody
  • MTMR11 polyclonal antibody

MTMR11 polyclonal antibody

Ref: AB-PAB22436
MTMR11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MTMR11.
Información adicional
Size 100 uL
Gene Name MTMR11
Gene Alias CRA|RP11-212K13.1
Gene Description myotubularin related protein 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FLLALHDSVRVPDTLTFLRNTPWERGKQSGQLNSYTQVYTPGYSQPPAGNSFNLQLSVWDWDLRYSNAQILQFQNPGYDPEHCPDSWLPRPQPSFMVPG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MTMR11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10903
Iso type IgG

Enviar uma mensagem


MTMR11 polyclonal antibody

MTMR11 polyclonal antibody