FRMD1 polyclonal antibody
  • FRMD1 polyclonal antibody

FRMD1 polyclonal antibody

Ref: AB-PAB22435
FRMD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FRMD1.
Información adicional
Size 100 uL
Gene Name FRMD1
Gene Alias DKFZp434O0117|FLJ00181|FLJ22615|FLJ40260|bA164L23.1
Gene Description FERM domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RYFEPHSYFPQWIITKRGIDYILRHMPTLHRERQGLSPKEAMLCFIQEACRLEDVPVHFFRLHKDKKEGRPTVILGLALRGVHIYQGKKLEI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FRMD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79981
Iso type IgG

Enviar uma mensagem


FRMD1 polyclonal antibody

FRMD1 polyclonal antibody