MRPL24 polyclonal antibody
  • MRPL24 polyclonal antibody

MRPL24 polyclonal antibody

Ref: AB-PAB22430
MRPL24 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MRPL24.
Información adicional
Size 100 uL
Gene Name MRPL24
Gene Alias FLJ20917|L24mt|MGC22737|MGC9831|MRP-L18|MRP-L24
Gene Description mitochondrial ribosomal protein L24
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GKVVQVIRQRNWVVVGGLNTHYRYIGKTMDYRGTMIPSEAPLLHRQVKLVDPMDRKPTEIEWRFTEAG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MRPL24.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79590
Iso type IgG

Enviar uma mensagem


MRPL24 polyclonal antibody

MRPL24 polyclonal antibody