C1orf62 polyclonal antibody
  • C1orf62 polyclonal antibody

C1orf62 polyclonal antibody

Ref: AB-PAB22426
C1orf62 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1orf62.
Información adicional
Size 100 uL
Gene Name C1orf62
Gene Alias MGC26989
Gene Description chromosome 1 open reading frame 62
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PQEKAMHNETCGNTAVTIPLGKITENAANKKDEKEKQCTAALHIPANEGDASKSSISDILLHHLSKEPFLRGQGIDCETL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C1orf62.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 254268
Iso type IgG

Enviar uma mensagem


C1orf62 polyclonal antibody

C1orf62 polyclonal antibody