MLLT4 polyclonal antibody
  • MLLT4 polyclonal antibody

MLLT4 polyclonal antibody

Ref: AB-PAB22417
MLLT4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MLLT4.
Información adicional
Size 100 uL
Gene Name MLLT4
Gene Alias AF-6|AF6|AFADIN|FLJ34371|RP3-431P23.3
Gene Description myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq ASHVFKFVDPSQDHALAKRSVDGGLMVKGPRHKPGIVQETTFDLGGDIHSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQQPDYRRQESRTQD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MLLT4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4301
Iso type IgG

Enviar uma mensagem


MLLT4 polyclonal antibody

MLLT4 polyclonal antibody