LTV1 polyclonal antibody
  • LTV1 polyclonal antibody

LTV1 polyclonal antibody

Ref: AB-PAB22403
LTV1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LTV1.
Información adicional
Size 100 uL
Gene Name LTV1
Gene Alias C6orf93|FLJ14909|dJ468K18.4
Gene Description LTV1 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq ATGEEEGMDIQKSENEDDSEWEDVDDEKGDSNDDYDSAGLLSDEDCMSVPGKTHRAIADHLFWSEETKSRFTEYSM
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LTV1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84946
Iso type IgG

Enviar uma mensagem


LTV1 polyclonal antibody

LTV1 polyclonal antibody