YRDC polyclonal antibody
  • YRDC polyclonal antibody

YRDC polyclonal antibody

Ref: AB-PAB22400
YRDC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant YRDC.
Información adicional
Size 100 uL
Gene Name YRDC
Gene Alias DRIP3|FLJ23476|FLJ26165|IRIP|RP11-109P14.4|SUA5
Gene Description yrdC domain containing (E. coli)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ASSLNVEEFQDLWPQLSLVIDGGQIGDGQSPECRLGSTVVDLSVPGKFGIIRPGCALESTTAILQQKYGLLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human YRDC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79693
Iso type IgG

Enviar uma mensagem


YRDC polyclonal antibody

YRDC polyclonal antibody