NUDT17 polyclonal antibody
  • NUDT17 polyclonal antibody

NUDT17 polyclonal antibody

Ref: AB-PAB22399
NUDT17 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NUDT17.
Información adicional
Size 100 uL
Gene Name NUDT17
Gene Alias FLJ34433
Gene Description nudix (nucleoside diphosphate linked moiety X)-type motif 17
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RLSWGLPKYHHIVLYLLVISQESQQQLQARIQPNPNEVSALMWLTPDVAAAVAAAEDGTETPGLLPQDLPPSV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NUDT17.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 200035
Iso type IgG

Enviar uma mensagem


NUDT17 polyclonal antibody

NUDT17 polyclonal antibody