FAM136A polyclonal antibody
  • FAM136A polyclonal antibody

FAM136A polyclonal antibody

Ref: AB-PAB22390
FAM136A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM136A.
Información adicional
Size 100 uL
Gene Name FAM136A
Gene Alias FLJ14668
Gene Description family with sequence similarity 136, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM136A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84908
Iso type IgG

Enviar uma mensagem


FAM136A polyclonal antibody

FAM136A polyclonal antibody