INSL5 polyclonal antibody
  • INSL5 polyclonal antibody

INSL5 polyclonal antibody

Ref: AB-PAB22388
INSL5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant INSL5.
Información adicional
Size 100 uL
Gene Name INSL5
Gene Alias MGC126695|MGC126697|PRO182|UNQ156
Gene Description insulin-like 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LEYIRTVIYICASSRWRRHLEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human INSL5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10022
Iso type IgG

Enviar uma mensagem


INSL5 polyclonal antibody

INSL5 polyclonal antibody