SPATA17 polyclonal antibody
  • SPATA17 polyclonal antibody

SPATA17 polyclonal antibody

Ref: AB-PAB22387
SPATA17 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPATA17.
Información adicional
Size 100 uL
Gene Name SPATA17
Gene Alias IQCH|MSRG-11|MSRG11|RP11-144C20.1
Gene Description spermatogenesis associated 17
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq KEPDPWELQLQKAKPLTHRRPKVKQKDSTSLTDWLACTSARSFPRSEILPPINRKQCQGPFRDITEVLEQRYRPLEPTLRVAEPIDEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPATA17.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 128153
Iso type IgG

Enviar uma mensagem


SPATA17 polyclonal antibody

SPATA17 polyclonal antibody